Double Wedding Ring
Also known as: Double Wedding Ring, Wedding Ring, Pickle Dish Variation
Interlocking rings of colorful arc segments symbolizing the unending bond of marriage, approximated with polygon wedges.
Block Details
- Category
- Curves
- Difficulty
- advanced
- Grid Type
- curved
- Piece Count
- 27
- Tags
- curvesringsweddingscrap-friendly
Block Details
- Category
- Curves
- Difficulty
- advanced
- Grid Type
- curved
- Piece Count
- 27
- Tags
- curvesringsweddingscrap-friendly
Construction Tips
The Double Wedding Ring requires curved piecing and careful template work. Each ring arc is assembled from small wedge-shaped pieces (typically 4-8 per arc) sewn in sequence. The melon-shaped patches at the ring intersections require concave-convex seam matching. Use freezer paper or acrylic templates designed for this specific pattern. Pin generously at the curves, clipping the concave seam allowance. Many modern quilters use specialty rulers that simplify the cutting. Spray starch helps maintain fabric stability on the bias edges.
Related Blocks
Bear's Paw
Four paws, each a large square with two half-square-triangle claws along each of its two outer sides and a small background square in the outer corner, separated by sashing strips around a centre square.
Log Cabin
A centre square wrapped in five rounds of logs that spiral around it, one log per side in turn; the logs on two adjacent sides are light and the other two are dark, so the block divides into light and dark halves along a diagonal.
Lone Star
An eight-pointed star of 45-degree diamonds, each point pieced from small diamonds in rings of colour that radiate from the centre, with set-in background corners and side triangles.
Ohio Star
A nine-patch star: plain corners, a centre square, and quarter-square-triangle side units whose triangles form eight points.
Alaska Homestead
Four large half-square triangle units in the corners with their inner halves framing a centre cross of five squares, the edge and centre squares in one fabric and the squares between them in another.
Anvil
Two large half-square triangles meet at the centre on one diagonal; the other two quarters each hold a square, a background square and two small triangles.